Agent skill
pyopenms
Mass spectrometry toolkit (OpenMS Python). Process mzML/mzXML, peak picking, feature detection, peptide ID, proteomics/metabolomics workflows, for LC-MS/MS analysis.
Install this agent skill to your Project
npx add-skill https://github.com/lifangda/claude-plugins/tree/main/cli-tool/skills-library/scientific-computing/proteomics/pyopenms
SKILL.md
pyOpenMS
Overview
pyOpenMS is an open-source Python library for mass spectrometry data analysis in proteomics and metabolomics. Process LC-MS/MS data, perform peptide identification, detect and quantify features, and integrate with common proteomics tools (Comet, Mascot, MSGF+, Percolator, MSstats) using Python bindings to the OpenMS C++ library.
When to Use This Skill
This skill should be used when:
- Processing mass spectrometry data (mzML, mzXML files)
- Performing peak picking and feature detection in LC-MS data
- Conducting peptide and protein identification workflows
- Quantifying metabolites or proteins
- Integrating proteomics or metabolomics tools into Python pipelines
- Working with OpenMS tools and file formats
Core Capabilities
1. File I/O and Data Import/Export
Handle diverse mass spectrometry file formats efficiently:
Supported Formats:
- mzML/mzXML: Primary raw MS data formats (profile or centroid)
- FASTA: Protein/peptide sequence databases
- mzTab: Standardized reporting format for identification and quantification
- mzIdentML: Peptide and protein identification data
- TraML: Transition lists for targeted experiments
- pepXML/protXML: Search engine results
Reading mzML Files:
import pyopenms as oms
# Load MS data
exp = oms.MSExperiment()
oms.MzMLFile().load("input_data.mzML", exp)
# Access basic information
print(f"Number of spectra: {exp.getNrSpectra()}")
print(f"Number of chromatograms: {exp.getNrChromatograms()}")
Writing mzML Files:
# Save processed data
oms.MzMLFile().store("output_data.mzML", exp)
File Encoding: pyOpenMS automatically handles Base64 encoding, zlib compression, and Numpress compression internally.
2. MS Data Structures and Manipulation
Work with core mass spectrometry data structures. See references/data_structures.md for comprehensive details.
MSSpectrum - Individual mass spectrum:
# Create spectrum with metadata
spectrum = oms.MSSpectrum()
spectrum.setRT(205.2) # Retention time in seconds
spectrum.setMSLevel(2) # MS2 spectrum
# Set peak data (m/z, intensity arrays)
mz_array = [100.5, 200.3, 300.7, 400.2]
intensity_array = [1000, 5000, 3000, 2000]
spectrum.set_peaks((mz_array, intensity_array))
# Add precursor information for MS2
precursor = oms.Precursor()
precursor.setMZ(450.5)
precursor.setCharge(2)
spectrum.setPrecursors([precursor])
MSExperiment - Complete LC-MS/MS run:
# Create experiment and add spectra
exp = oms.MSExperiment()
exp.addSpectrum(spectrum)
# Access spectra
first_spectrum = exp.getSpectrum(0)
for spec in exp:
print(f"RT: {spec.getRT()}, MS Level: {spec.getMSLevel()}")
MSChromatogram - Extracted ion chromatogram:
# Create chromatogram
chrom = oms.MSChromatogram()
chrom.set_peaks(([10.5, 11.2, 11.8], [1000, 5000, 3000])) # RT, intensity
exp.addChromatogram(chrom)
Efficient Peak Access:
# Get peaks as numpy arrays for fast processing
mz_array, intensity_array = spectrum.get_peaks()
# Modify and set back
intensity_array *= 2 # Double all intensities
spectrum.set_peaks((mz_array, intensity_array))
3. Chemistry and Peptide Handling
Perform chemical calculations for proteomics and metabolomics. See references/chemistry.md for detailed examples.
Molecular Formulas and Mass Calculations:
# Create empirical formula
formula = oms.EmpiricalFormula("C6H12O6") # Glucose
print(f"Monoisotopic mass: {formula.getMonoWeight()}")
print(f"Average mass: {formula.getAverageWeight()}")
# Formula arithmetic
water = oms.EmpiricalFormula("H2O")
dehydrated = formula - water
# Isotope-specific formulas
heavy_carbon = oms.EmpiricalFormula("(13)C6H12O6")
Isotopic Distributions:
# Generate coarse isotope pattern (unit mass resolution)
coarse_gen = oms.CoarseIsotopePatternGenerator()
pattern = coarse_gen.run(formula)
# Generate fine structure (high resolution)
fine_gen = oms.FineIsotopePatternGenerator(0.01) # 0.01 Da resolution
fine_pattern = fine_gen.run(formula)
Amino Acids and Residues:
# Access residue information
res_db = oms.ResidueDB()
leucine = res_db.getResidue("Leucine")
print(f"L monoisotopic mass: {leucine.getMonoWeight()}")
print(f"L formula: {leucine.getFormula()}")
print(f"L pKa: {leucine.getPka()}")
Peptide Sequences:
# Create peptide sequence
peptide = oms.AASequence.fromString("PEPTIDE")
print(f"Peptide mass: {peptide.getMonoWeight()}")
print(f"Formula: {peptide.getFormula()}")
# Add modifications
modified = oms.AASequence.fromString("PEPTIDEM(Oxidation)")
print(f"Modified mass: {modified.getMonoWeight()}")
# Theoretical fragmentation
ions = []
for i in range(1, peptide.size()):
b_ion = peptide.getPrefix(i)
y_ion = peptide.getSuffix(i)
ions.append(('b', i, b_ion.getMonoWeight()))
ions.append(('y', i, y_ion.getMonoWeight()))
Protein Digestion:
# Enzymatic digestion
dig = oms.ProteaseDigestion()
dig.setEnzyme("Trypsin")
dig.setMissedCleavages(2)
protein_seq = oms.AASequence.fromString("MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEK")
peptides = []
dig.digest(protein_seq, peptides)
for pep in peptides:
print(f"{pep.toString()}: {pep.getMonoWeight():.2f} Da")
Modifications:
# Access modification database
mod_db = oms.ModificationsDB()
oxidation = mod_db.getModification("Oxidation")
print(f"Oxidation mass diff: {oxidation.getDiffMonoMass()}")
print(f"Residues: {oxidation.getResidues()}")
4. Signal Processing and Filtering
Apply algorithms to process and filter MS data. See references/algorithms.md for comprehensive coverage.
Spectral Smoothing:
# Gaussian smoothing
gauss_filter = oms.GaussFilter()
params = gauss_filter.getParameters()
params.setValue("gaussian_width", 0.2)
gauss_filter.setParameters(params)
gauss_filter.filterExperiment(exp)
# Savitzky-Golay filter
sg_filter = oms.SavitzkyGolayFilter()
sg_filter.filterExperiment(exp)
Peak Filtering:
# Keep only N largest peaks per spectrum
n_largest = oms.NLargest()
params = n_largest.getParameters()
params.setValue("n", 100) # Keep top 100 peaks
n_largest.setParameters(params)
n_largest.filterExperiment(exp)
# Threshold filtering
threshold_filter = oms.ThresholdMower()
params = threshold_filter.getParameters()
params.setValue("threshold", 1000.0) # Remove peaks below 1000 intensity
threshold_filter.setParameters(params)
threshold_filter.filterExperiment(exp)
# Window-based filtering
window_filter = oms.WindowMower()
params = window_filter.getParameters()
params.setValue("windowsize", 50.0) # 50 m/z windows
params.setValue("peakcount", 10) # Keep 10 highest per window
window_filter.setParameters(params)
window_filter.filterExperiment(exp)
Spectrum Normalization:
normalizer = oms.Normalizer()
normalizer.filterExperiment(exp)
MS Level Filtering:
# Keep only MS2 spectra
exp.filterMSLevel(2)
# Filter by retention time range
exp.filterRT(100.0, 500.0) # Keep RT between 100-500 seconds
# Filter by m/z range
exp.filterMZ(400.0, 1500.0) # Keep m/z between 400-1500
5. Feature Detection and Quantification
Detect and quantify features in LC-MS data:
Peak Picking (Centroiding):
# Convert profile data to centroid
picker = oms.PeakPickerHiRes()
params = picker.getParameters()
params.setValue("signal_to_noise", 1.0)
picker.setParameters(params)
exp_centroided = oms.MSExperiment()
picker.pickExperiment(exp, exp_centroided)
Feature Detection:
# Detect features across LC-MS runs
feature_finder = oms.FeatureFinderMultiplex()
features = oms.FeatureMap()
feature_finder.run(exp, features, params)
print(f"Found {features.size()} features")
for feature in features:
print(f"m/z: {feature.getMZ():.4f}, RT: {feature.getRT():.2f}, "
f"Intensity: {feature.getIntensity():.0f}")
Feature Linking (Map Alignment):
# Link features across multiple samples
feature_grouper = oms.FeatureGroupingAlgorithmQT()
consensus_map = oms.ConsensusMap()
# Provide multiple feature maps from different samples
feature_maps = [features1, features2, features3]
feature_grouper.group(feature_maps, consensus_map)
6. Peptide Identification Workflows
Integrate with search engines and process identification results:
Database Searching:
# Prepare parameters for search engine
params = oms.Param()
params.setValue("database", "uniprot_human.fasta")
params.setValue("precursor_mass_tolerance", 10.0) # ppm
params.setValue("fragment_mass_tolerance", 0.5) # Da
params.setValue("enzyme", "Trypsin")
params.setValue("missed_cleavages", 2)
# Variable modifications
params.setValue("variable_modifications", ["Oxidation (M)", "Phospho (STY)"])
# Fixed modifications
params.setValue("fixed_modifications", ["Carbamidomethyl (C)"])
FDR Control:
# False discovery rate estimation
fdr = oms.FalseDiscoveryRate()
fdr_threshold = 0.01 # 1% FDR
# Apply to peptide identifications
protein_ids = []
peptide_ids = []
oms.IdXMLFile().load("search_results.idXML", protein_ids, peptide_ids)
fdr.apply(protein_ids, peptide_ids)
7. Metabolomics Workflows
Analyze small molecule data:
Adduct Detection:
# Common metabolite adducts
adducts = ["[M+H]+", "[M+Na]+", "[M+K]+", "[M-H]-", "[M+Cl]-"]
# Feature annotation with adducts
for feature in features:
mz = feature.getMZ()
# Calculate neutral mass for each adduct hypothesis
for adduct in adducts:
# Annotation logic
pass
Isotope Pattern Matching:
# Compare experimental to theoretical isotope patterns
experimental_pattern = [] # Extract from feature
theoretical = coarse_gen.run(formula)
# Calculate similarity score
similarity = compare_isotope_patterns(experimental_pattern, theoretical)
8. Quality Control and Visualization
Monitor data quality and visualize results:
Basic Statistics:
# Calculate TIC (Total Ion Current)
tic_values = []
rt_values = []
for spectrum in exp:
if spectrum.getMSLevel() == 1:
tic = sum(spectrum.get_peaks()[1]) # Sum intensities
tic_values.append(tic)
rt_values.append(spectrum.getRT())
# Base peak chromatogram
bpc_values = []
for spectrum in exp:
if spectrum.getMSLevel() == 1:
max_intensity = max(spectrum.get_peaks()[1]) if spectrum.size() > 0 else 0
bpc_values.append(max_intensity)
Plotting (with pyopenms.plotting or matplotlib):
import matplotlib.pyplot as plt
# Plot TIC
plt.figure(figsize=(10, 4))
plt.plot(rt_values, tic_values)
plt.xlabel('Retention Time (s)')
plt.ylabel('Total Ion Current')
plt.title('TIC')
plt.show()
# Plot single spectrum
spectrum = exp.getSpectrum(0)
mz, intensity = spectrum.get_peaks()
plt.stem(mz, intensity, basefmt=' ')
plt.xlabel('m/z')
plt.ylabel('Intensity')
plt.title(f'Spectrum at RT {spectrum.getRT():.2f}s')
plt.show()
Common Workflows
Complete LC-MS/MS Processing Pipeline
import pyopenms as oms
# 1. Load data
exp = oms.MSExperiment()
oms.MzMLFile().load("raw_data.mzML", exp)
# 2. Filter and smooth
exp.filterMSLevel(1) # Keep only MS1 for feature detection
gauss = oms.GaussFilter()
gauss.filterExperiment(exp)
# 3. Peak picking
picker = oms.PeakPickerHiRes()
exp_centroid = oms.MSExperiment()
picker.pickExperiment(exp, exp_centroid)
# 4. Feature detection
ff = oms.FeatureFinderMultiplex()
features = oms.FeatureMap()
ff.run(exp_centroid, features, oms.Param())
# 5. Export results
oms.FeatureXMLFile().store("features.featureXML", features)
print(f"Detected {features.size()} features")
Theoretical Peptide Mass Calculation
# Calculate masses for peptide with modifications
peptide = oms.AASequence.fromString("PEPTIDEK")
print(f"Unmodified [M+H]+: {peptide.getMonoWeight() + 1.007276:.4f}")
# With modification
modified = oms.AASequence.fromString("PEPTIDEM(Oxidation)K")
print(f"Oxidized [M+H]+: {modified.getMonoWeight() + 1.007276:.4f}")
# Calculate for different charge states
for z in [1, 2, 3]:
mz = (peptide.getMonoWeight() + z * 1.007276) / z
print(f"[M+{z}H]^{z}+: {mz:.4f}")
Installation
Ensure pyOpenMS is installed before using this skill:
# Via conda (recommended)
conda install -c bioconda pyopenms
# Via pip
pip install pyopenms
Integration with Other Tools
pyOpenMS integrates seamlessly with:
- Search Engines: Comet, Mascot, MSGF+, MSFragger, Sage, SpectraST
- Post-processing: Percolator, MSstats, Epiphany
- Metabolomics: SIRIUS, CSI:FingerID
- Data Analysis: Pandas, NumPy, SciPy for downstream analysis
- Visualization: Matplotlib, Seaborn for plotting
Resources
references/
Detailed documentation on core concepts:
- data_structures.md - Comprehensive guide to MSExperiment, MSSpectrum, MSChromatogram, and peak data handling
- algorithms.md - Complete reference for signal processing, filtering, feature detection, and quantification algorithms
- chemistry.md - In-depth coverage of chemistry calculations, peptide handling, modifications, and isotope distributions
Load these references when needing detailed information about specific pyOpenMS capabilities.
Best Practices
- File Format: Always use mzML for raw MS data (standardized, well-supported)
- Peak Access: Use
get_peaks()andset_peaks()with numpy arrays for efficient processing - Parameters: Always check and configure algorithm parameters via
getParameters()andsetParameters() - Memory: For large datasets, process spectra iteratively rather than loading entire experiments
- Validation: Check data integrity (MS levels, RT ordering, precursor information) after loading
- Modifications: Use standard modification names from UniMod database
- Units: RT in seconds, m/z in Thomson (Da/charge), intensity in arbitrary units
Common Patterns
Algorithm Application Pattern:
# 1. Instantiate algorithm
algorithm = oms.SomeAlgorithm()
# 2. Get and configure parameters
params = algorithm.getParameters()
params.setValue("parameter_name", value)
algorithm.setParameters(params)
# 3. Apply to data
algorithm.filterExperiment(exp) # or .process(), .run(), depending on algorithm
File I/O Pattern:
# Read
data_container = oms.DataContainer() # MSExperiment, FeatureMap, etc.
oms.FileHandler().load("input.format", data_container)
# Process
# ... manipulate data_container ...
# Write
oms.FileHandler().store("output.format", data_container)
Getting Help
- Documentation: https://pyopenms.readthedocs.io/
- API Reference: Browse class documentation for detailed method signatures
- OpenMS Website: https://www.openms.org/
- GitHub Issues: https://github.com/OpenMS/OpenMS/issues
Recommended Agent Skills
Expand your agent's capabilities with these related and highly-rated skills.
metabolomics-workbench-database
Access NIH Metabolomics Workbench via REST API (4,200+ studies). Query metabolites, RefMet nomenclature, MS/NMR data, m/z searches, study metadata, for metabolomics and biomarker discovery.
zinc-database
Access ZINC (230M+ purchasable compounds). Search by ZINC ID/SMILES, similarity searches, 3D-ready structures for docking, analog discovery, for virtual screening and drug discovery.
drugbank-database
Access and analyze comprehensive drug information from the DrugBank database including drug properties, interactions, targets, pathways, chemical structures, and pharmacology data. This skill should be used when working with pharmaceutical data, drug discovery research, pharmacology studies, drug-drug interaction analysis, target identification, chemical similarity searches, ADMET predictions, or any task requiring detailed drug and drug target information from DrugBank.
pubmed-database
Direct REST API access to PubMed. Advanced Boolean/MeSH queries, E-utilities API, batch processing, citation management. For Python workflows, prefer biopython (Bio.Entrez). Use this for direct HTTP/REST work or custom API implementations.
reactome-database
Query Reactome REST API for pathway analysis, enrichment, gene-pathway mapping, disease pathways, molecular interactions, expression analysis, for systems biology studies.
alphafold-database
Access AlphaFold's 200M+ AI-predicted protein structures. Retrieve structures by UniProt ID, download PDB/mmCIF files, analyze confidence metrics (pLDDT, PAE), for drug discovery and structural biology.
Didn't find tool you were looking for?